Home | Human | Mouse | Chicken | Frog | Zebrafish | Amphioxus | Fruitfly | Beetle | Honeybee | Nematode
Total | HomeoReg | Summary | Download | Compare | BLAST | Search (gene symbol, e.g. HOX)

Download Sequence
Downloaded sequences will be in FASTA format:
>Species_Name|Gene_Symbol|[HDn|]Belonging_Family_Name|Belonging_Class_Name
AAAAAA...[sequence]...AAAAAA

Where HDn will be optional. When there are more then one homeodomain sequences in one gene, it will be included in the title as HD1, HD2, ....

For examples:
>Human|CDX1|Cdx|ANTP
KDKYRVVYTDHQRLELEKEFHYSRYITIRRKSELAANLGLTERQVKIWFQNRRAKERKVN
>Human|DUX4|HD1|Dux|PRD
GRRKRTAVTGSQTALLLRAFEKDRFPGIAAREELARETGLPESRIQIWFQNRRARHPGQG
>Human|DUX4|HD2|Dux|PRD
GRRRRLVWTPSQSEALRACFERNPYPGIATRERLAQAIGIPEPRVQIWFQNERSRQLRQH

..., according to Species.
HumanMouseChickenZebrafishFrogAmphioxusFruitfly
BeetleHoneybeeNematode    

..., and/or according to Classes or Families.
ClassesFamilies
ANTP
HOXL subclass
CdxEvxGbxGsxHox1Hox2Hox3
Hox4Hox5Hox6-8Hox9-13(15)MeoxMnxPdx
NKL subclass
AboxAnkxBarhlBariBarxBsxDbx
DlxEmxEnHhexHlxHxLbx
LcxMsxMsxlxNanogNedxNk1Nk2.1
Nk2.2Nk3Nk4Nk5/HmxNk6Nk7Noto
RoTlxVaxVentx    
PRD
AlxAprdAAprdBAprdCAprdDAprdEArgfx
ArxCG11294DmbxDprxDrgxDuxEsx
GscHbnHesxHopxIsxLeutxMix
NoboxOboxOtpOtxPax2/5/8Pax3/7Pax4/6
PhoxPitxPropPrrxRaxRepoRhox
SeboxShoxTprxUncxVsx   
LIM
IslLhx1/5Lhx2/9Lhx3/4Lhx6/8Lmx  
POU
HdxPou1Pou2Pou3Pou4Pou5Pou6
HNF
AhnfxHmboxHnf1     
SINE
Six1/2Six3/6Six4/5     
TALE
AtaleIrxMeisMkxPbxPknoxTgif
CUT
AcutCmpCuxOnecutSatb   
PROS
Prox       
ZF
AdnpAzfhTshzZebZfhxZhx/Homez  
CERS
Cers       
Other
AhbxBeetleboxBixCphxCrxos1Gm5585Gm7235
LOC647589MuxaMuxbNANOGNBSiaunassigned